The domain within your query sequence starts at position 653 and ends at position 933; the E-value for the GKAP domain shown below is 9.5e-106.

EDRKKDFKKNRCLSIGIQVDDAEEPEKMAESKTSNKFQSVGVQVEEEKCFRRFTRSNSVT
TAVQADLDFHDNLENSLESIEDNSCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDF
DTDFDPSILPPPDPWIDSITEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCKLMERE
ERENNLPEDILGKIRTAVGSAQLLMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDML
QLSIENISMKFDELHQLKANNWKQMDPLDKKVEQCRFCMVH

GKAP

GKAP
PFAM accession number:PF03359
Interpro abstract (IPR005026):

This entry represents the SAPAP family, whose members include mars from fruit flies and disks large-associated proteins from vertebrates.

Mars binds to microtubules and protein phosphatase 1. It is involved in cell signalling, mitotic spindle organisation and regulation of mitotic cell cycle [(PUBMED:23593258), (PUBMED:17007873)]. It is essential for the early development of Drosophila embryos [(PUBMED:23593258)].

Disks large-associated proteins are synaptic proteins that may play several roles in the molecular organisation of synapses and neuronal cell signalling [(PUBMED:9024696), (PUBMED:9286858)].

GO process:signaling (GO:0023052)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GKAP