The domain within your query sequence starts at position 397 and ends at position 650; the E-value for the GLE1 domain shown below is 2.4e-90.

ASAKCVLAFEDLTSSKDSQTKKIKMDLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGK
PVQSGGRSVSVTLNPQGLDFVQYKLAEKFVKQGEEEVASHHEAAFPIAVVASGIWMLHPK
VGDLILAHLHKKCPYSVPFYPAFKEGMALEDYQRMLGYQVTDSKVEQQDNFLKRMSGMIR
LYAAIIQLQWPYGNRQEAHPHGLNHGWRWLAQVLNMEPLSDVTATLLFDFLEVCGNALMK
QYQVQFWKMILLIK

GLE1

GLE1
PFAM accession number:PF07817
Interpro abstract (IPR012476):

The members of this family are sequences that are similar to the human protein GLE1 (O75458). This protein is localised at the nuclear pore complexes and functions in poly(A)+ RNA export to the cytoplasm [(PUBMED:9618489)].

GO process:poly(A)+ mRNA export from nucleus (GO:0016973)
GO component:nuclear pore (GO:0005643)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GLE1