The domain within your query sequence starts at position 283 and ends at position 429; the E-value for the GLTP domain shown below is 3.5e-45.

SGIPTEAFLASCYAVVPVLDKLGPTVFAPVKMDLVGNIKKVNQKYITNKEEFTTLQKIVL
HEVEADVAQVRNSATEALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGW
VVRGVFALALRAAPSYEDFVAALTIKE

GLTP

GLTP
PFAM accession number:PF08718
Interpro abstract (IPR014830):

Glycolipid transfer protein (GLTP) is a cytosolic protein that catalyses the intermembrane transfer of glycolipids such as glycosphingolipids, glyceroglycolipids, and possibly glucosylceramides, but not of phospholipids. The GLTP protein consists of a single domain with a multi-helical structure consisting of two layers of orthogonally packed helices [(PUBMED:15504043), (PUBMED:16309699)].

The GLTP domain is also found in trans-Golgi network proteins involved in Golgi-to-cell-surface membrane traffic [(PUBMED:15107860)].

GO process:intermembrane lipid transfer (GO:0120009)
GO component:cytoplasm (GO:0005737)
GO function:intermembrane lipid transfer activity (GO:0120013)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GLTP