The domain within your query sequence starts at position 1094 and ends at position 1202; the E-value for the GLTSCR1 domain shown below is 4.6e-43.
FLEHLHKHQGSVLHPDYKTAFPSFEDALHRLLPYHVYQGALPSPNDYHKVDEEFETVSTQ LLKRTQAMLNKYRLLLLEESRRVSPSAEMVMIDRMFIQEEKTTLALDKQ
GLTSCR1 |
---|
PFAM accession number: | PF15249 |
---|---|
Interpro abstract (IPR015671): | This domain is found in glioma tumour suppressor candidate region gene 1 (GLTSCR1) protein, and is typically between 105 and 124 amino acids in length. There is a single completely conserved residue F that may be functionally important. Mutations in the gene for this protein in humans leads to the development of oligodendrogliomas [ (PUBMED:15834925) ]. There is evidence that these protein interacts with SH3 domains [ (PUBMED:17474147) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GLTSCR1