SMART: Pfam domain GLYCAM-1

The domain within your query sequence starts at position 20 and ends at position 151; the E-value for the GLYCAM-1 domain shown below is 6e-62.

LPGSKDELQMKTQPTDAIPAAQSTPTSYTSEESTSSKDLSKEPSIFREELISKDNVVIES
TKPENQEAQDGLRSGSSQLEETTRPTTSAATTSEENLTKSSQTVEEELGKIIEGFVTGAE
DIISGASRITKS

GLYCAM-1

PFAM accession number:	PF05242
Interpro abstract (IPR007906):	This family consists of the lactophorin precursors proteose peptone component 3 (PP3) and glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1). GlyCAM-1 functions as a ligand for L-selectin, a saccharide-binding protein on the surface of circulating leukocytes, and mediates the trafficking of blood-born lymphocytes into secondary lymph nodes. In this context, sulphatation of the carbohydrates of GlyCAM-1 has been shown to be a critical structural requirement to be recognised by L-selectin. GlyCAM-1 is also expressed in pregnant and lactating mammary glands of mouse and in an unknown site in the lung, in the bovine uterus and rat cochlea [ (PUBMED:12057858) ].

PFAM accession number:

PF05242

Interpro abstract (IPR007906):

This family consists of the lactophorin precursors proteose peptone component 3 (PP3) and glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1). GlyCAM-1 functions as a ligand for L-selectin, a saccharide-binding protein on the surface of circulating leukocytes, and mediates the trafficking of blood-born lymphocytes into secondary lymph nodes. In this context, sulphatation of the carbohydrates of GlyCAM-1 has been shown to be a critical structural requirement to be recognised by L-selectin. GlyCAM-1 is also expressed in pregnant and lactating mammary glands of mouse and in an unknown site in the lung, in the bovine uterus and rat cochlea [ (PUBMED:12057858) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GLYCAM-1