The domain within your query sequence starts at position 43 and ends at position 341; the E-value for the GMC_oxred_N domain shown below is 2.4e-98.

YTFVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCD
DKYNWYYHTEPQPGMDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDY
AHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQAFLQAARQAGYPFTEDMNGF
QQEGFGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAVGVEYIKD
GQRHKAYVSREVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDHLE

GMC_oxred_N

GMC_oxred_N
PFAM accession number:PF00732
Interpro abstract (IPR000172):

The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [(PUBMED:1542121), (PUBMED:8218217)]. These enzymes include a variety of proteins; choline dehydrogenase (CHD), methanol oxidase (MOX) and cellobiose dehydrogenase (EC 1.1.99.18) [(PUBMED:10725534)] which share a number of regions of sequence similarities. One of these regions, located in the N-terminal section, corresponds to the FAD ADP- binding domain. The function of the other conserved domains is not yet known.

GO process:oxidation-reduction process (GO:0055114)
GO function:oxidoreductase activity, acting on CH-OH group of donors (GO:0016614), flavin adenine dinucleotide binding (GO:0050660)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMC_oxred_N