The domain within your query sequence starts at position 43 and ends at position 341; the E-value for the GMC_oxred_N domain shown below is 2.4e-98.
YTFVVVGAGSAGCVLASRLTEDPNHRVLLLEAGPKDLLMGSKRLQWKIHMPAALVSNLCD DKYNWYYHTEPQPGMDSRVLYWPRGRVWGGSSSLNAMVYIRGHAEDYNRWHREGAEGWDY AHCLPYFRKAQRHELGANMYRGGDGPLHVSRGKTNHPLHQAFLQAARQAGYPFTEDMNGF QQEGFGWMDMTVHQGKRWSTACAYLHPVLSRPNLRAEVQTLVSRVLFEGTRAVGVEYIKD GQRHKAYVSREVILSGGAINSPQLLMLSGVGNADDLRKLDIPVVCHLPGVGQNLQDHLE
GMC_oxred_N |
---|
PFAM accession number: | PF00732 |
---|---|
Interpro abstract (IPR000172): | The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [ (PUBMED:1542121) (PUBMED:8218217) ]. These enzymes include a variety of proteins; choline dehydrogenase (CHD), methanol oxidase (MOX) and cellobiose dehydrogenase ( EC 1.1.99.18 ) [ (PUBMED:10725534) ] which share a number of regions of sequence similarities. One of these regions, located in the N-terminal section, corresponds to the FAD ADP- binding domain. The function of the other conserved domains is not yet known. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | flavin adenine dinucleotide binding (GO:0050660), oxidoreductase activity, acting on CH-OH group of donors (GO:0016614) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMC_oxred_N