The domain within your query sequence starts at position 80 and ends at position 212; the E-value for the GMP_PDE_delta domain shown below is 1.3e-60.

EENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLR
LRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPL
SEELILKSLQGLA

GMP_PDE_delta

GMP_PDE_delta
PFAM accession number:PF05351
Interpro abstract (IPR008015):

This entry represents a domain found in GMP-PDE delta subunit and related proteins.

GMP-PDE delta subunit was originally identified as a fourth subunit of rod-specific cGMP phosphodiesterase (PDE) (EC 3.1.4.35). The precise function of PDE delta subunit in the rod specific GMP-PDE complex is unclear. In addition, PDE delta subunit is not confined to photoreceptor cells but is widely distributed in different tissues. PDE delta subunit is thought to be a specific soluble transport factor for certain prenylated proteins and Arl2-GTP a regulator of PDE-mediated transport [(PUBMED:11980706)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMP_PDE_delta