The domain within your query sequence starts at position 492 and ends at position 692; the E-value for the GMP_synt_C domain shown below is 1.4e-32.

EEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIP
RMCHNINRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGFAGKISQM
PVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGVPATPGNEIPVEVVLKMVTEIKK
IPGISRIMYDLTSKPPGTTEW

GMP_synt_C

GMP_synt_C
PFAM accession number:PF00958
Interpro abstract (IPR001674):

The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme. The ammonia intermediate does not dissociate into solution during the chemical transformations [(PUBMED:10387030)]. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. The C-terminal domain is specific to the GMP synthases EC 6.3.5.2. In prokaryotes this domain mediates dimerisation. Eukaryotic GMP synthases are monomers. This domain in eukaryotes includes several large insertions that may form globular domains [(PUBMED:8548458)].

GO process:GMP biosynthetic process (GO:0006177), purine nucleotide biosynthetic process (GO:0006164)
GO function:GMP synthase (glutamine-hydrolyzing) activity (GO:0003922), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GMP_synt_C