The domain within your query sequence starts at position 271 and ends at position 591; the E-value for the GNT-I domain shown below is 3e-52.

PLPDNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFG
LRGIQHTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHL
LEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKL
WDWDMWMRMPEQRRGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPGVQLRN
VDSLKKEAYEVEIHRLLSEAEVLDHSKDPCEDSFLPDTEGHTYVAFIRMETDDDFATWTQ
LAKCLHIWDLDVRGNHRGLWR

GNT-I

GNT-I
PFAM accession number:PF03071
Interpro abstract (IPR004139):

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates ([intenz:2.4.1.-]) and related proteins into distinct sequence based families has been described [ (PUBMED:9334165) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.

Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC 2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus, and is probably distributed in all tissues [ (PUBMED:10406843) ]. Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 (POMGNTI, GNT-I.2) participates in O-mannosyl glycosylation by catalyzing the addition of N-acetylglucosamine to O-linked mannose on glycoproteins [ (PUBMED:11709191) (PUBMED:27493216) (PUBMED:28512129) ]. These proteins are members of the glycosyl transferase family 13

GO process:protein glycosylation (GO:0006486)
GO function:acetylglucosaminyltransferase activity (GO:0008375)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GNT-I