The domain within your query sequence starts at position 381 and ends at position 999; the E-value for the GOLGA2L5 domain shown below is < 1e-12.

QLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHTLKEEKEHRERQVQELETSLA
ALRSQMEEPPPPEPPAGPSEAEEQLQGEVEQLHKELERLTGQLRAQVQDNESLSHLNREQ
EGRLLELEREAQRWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLT
NENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQ
QYAAAYQQHLAAYEQLTSEKEAIHKQLLLQTQLMDQLQHEEVQGKMAAELARQELQEAQE
RLKATSQENQQLQAQLSLLVLPGEGDVDQEEEDEEVPQSSLAIPEDLDSREAMVAFFNAA
IARAEEEQARLRVQLKEQKARCRSLSHLAAPVQSKLEKEAVVPRNVDDSASEESNQALHV
AMEKLQSRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLE
KEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPGDVLTPVPTGSQE
FGAADQQDDLREVSLADDIEPAQGEAGVPAPHENPTAQQIMQLLREIQNPRERPGLGSNP
CIPFFYRADENDEVKIMVV

GOLGA2L5

GOLGA2L5
PFAM accession number:PF15070
Interpro abstract (IPR024858): Members of the golgin subfamily A were identified as Golgi auto-antigens [(PUBMED:8315394)]. They might be involved in maintaining cis-Golgi structure [(PUBMED:10677249)]. One of the members of this family, member 2 or GM130, is a specific interacting partner of the small GTPase Rab1b [(PUBMED:11306556)].
GO component:Golgi apparatus (GO:0005794)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GOLGA2L5