The domain within your query sequence starts at position 156 and ends at position 468; the E-value for the GPCR_chapero_1 domain shown below is 5.5e-107.

RVDITLLGFENMSWIRGRRSFIFKGGDNWAELMEVNHDDRVVTTEHFDLSQEMERLTLDL
MKPKSREVERRLTSPVINTSLDTKNVAFERTKSGFWGWRTDKAEVVNGYEAKVYSVNNVS
VITRIRTEHLTEEEKKRYKEDRNPLESLLGTVEHQFGAQGDLATECATVNNPTAITPDEY
FDEDFDLKDRDIGRPKELTIRTQKFKATLWMCEEFPLSLVEQVIPIIDLMARTSAHFARL
RDFIKLDFPPGFPVKIEIPLFHVLNARITFGNVNGCSTADESQGVEGTPAEAVSEATNFE
VDQSVFEIPESYH

GPCR_chapero_1

GPCR_chapero_1
PFAM accession number:PF11904
Interpro abstract (IPR021832):

This entry represents ankyrin repeat domain-containing protein 13 (ANKRD13). At least 4 subtypes are known to exist, termed A-D. ANKRD13C has been experimentally characterised and acts as a chaperone for biogenesis and folding of the DP receptor for prostaglandin D2 [(PUBMED:20959461)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPCR_chapero_1