The domain within your query sequence starts at position 1394 and ends at position 1463; the E-value for the GPHH domain shown below is 2.3e-38.

LGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNM
PLNSDGTVTF

GPHH

GPHH
PFAM accession number:PF16905
Interpro abstract (IPR031649):

This entry represents a domain found in voltage-dependent L-type calcium channel proteins from eukaryotes. The domain is closely associated with the IQ-domain (IPR014873).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPHH