The domain within your query sequence starts at position 1457 and ends at position 1526; the E-value for the GPHH domain shown below is 2.7e-37.
LGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNV PLNSDGTVTF
GPHH |
---|
PFAM accession number: | PF16905 |
---|---|
Interpro abstract (IPR031649): | This entry represents a domain found in voltage-dependent L-type calcium channel proteins from eukaryotes. The domain is closely associated with the IQ-domain ( IPR014873 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPHH