The domain within your query sequence starts at position 140 and ends at position 207; the E-value for the GPHR_N domain shown below is 1.1e-31.
ILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQTMDM IISKKKRM
GPHR_N |
---|
PFAM accession number: | PF12537 |
---|---|
Interpro abstract (IPR022535): | This conserved domain is found in the Golgi pH regulator family, including human Golgi pH Regulators (GPHR) [ (PUBMED:18794847) ] and GPCR-type G proteins (GTG1 and GTG2) from Arabidopsis [ (PUBMED:19135895) ]. |
GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPHR_N