The domain within your query sequence starts at position 140 and ends at position 207; the E-value for the GPHR_N domain shown below is 1.1e-31.

ILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQTMDM
IISKKKRM

GPHR_N

GPHR_N
PFAM accession number:PF12537
Interpro abstract (IPR022535):

This conserved domain is found in the Golgi pH regulator family, including human Golgi pH Regulators (GPHR) [(PUBMED:18794847)] and GPCR-type G proteins (GTG1 and GTG2) from Arabidopsis [(PUBMED:19135895)].

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPHR_N