The domain within your query sequence starts at position 14 and ends at position 140; the E-value for the GPI2 domain shown below is 2.8e-39.

WQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWW
YMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRKKSGRTRWADLKSTLVFITFTYGF
SPVLKTL

GPI2

GPI2
PFAM accession number:PF06432
Interpro abstract (IPR009450):

This entry represents the subunit C of the phosphatidylinositol N-acetylglucosaminyltransferase (PIG-C) and its yeast homologue, Gpi2. It catalyses the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. This step involves products of three or four genes in both yeast (GPI1, GPI2 and GPI3) and mammals (GPI1, PIG A, PIG H and PIG C), respectively [(PUBMED:8806613)].

GO process:GPI anchor biosynthetic process (GO:0006506)
GO component:integral component of membrane (GO:0016021)
GO function:phosphatidylinositol N-acetylglucosaminyltransferase activity (GO:0017176)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPI2