The domain within your query sequence starts at position 141 and ends at position 229; the E-value for the GPS2_interact domain shown below is 4.9e-41.

LAGKLEPVSPPSPPHADPELELAPSRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQL
EEEAAKPPEPEKPVSPPPIESKHRSLVQI

GPS2_interact

GPS2_interact
PFAM accession number:PF15784
Interpro abstract (IPR031557):

The G-protein pathway suppressor 2 (GPS2)-interacting domain is found in NCoR (nuclear receptor corepressor) proteins. NCoR1 and NCoR2 (also known as SMRT) are related corepressors that mediate transcriptional repression by unliganded nuclear receptors and other classes of transcriptional repressors. GPS2 is a stoichiometric subunit of the N-CoR-HDAC3 complex. GPS2 links the complex to membrane receptor-related intracellular JNK (c-Jun amino-terminal kinase) signalling pathways [(PUBMED:11931768)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GPS2_interact