The domain within your query sequence starts at position 2 and ends at position 99; the E-value for the GRASP55_65 domain shown below is 2.6e-22.

GLGASSEQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKAN
VEKPVKLEVFNMKTMKVREVEVVPSNMWGGQGLLGASV

GRASP55_65

GRASP55_65
PFAM accession number:PF04495
Interpro abstract (IPR024958): GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous. GRASP55 is a component of the Golgi stacking machinery. GRASP65 is an N-ethylmaleimide-sensitive membrane protein required for the stacking of Golgi cisternae in a cell-free system [(PUBMED:10487747)].

This entry represents a domain found in GRASP55/65 that appears to be related to PDZ domains.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GRASP55_65