The domain within your query sequence starts at position 627 and ends at position 758; the E-value for the GRIN_C domain shown below is 2.7e-49.

VSEFLKELSVTAAAAQVGLTPGEKKKQLGADSKLHLKQSKRVRDVVWDDQGMTWEVYGAS
LDPESLGVAIQNHLQRQIREHEKIVKTQSGQTRRSISSDSSSSKKLKGRQHGVLQSMLQN
FRRPNCCVRPAP

GRIN_C

GRIN_C
PFAM accession number:PF15235
Interpro abstract (IPR032745):

This entry represents the C terminus of the G protein-regulated inducer of neurite outgrowth proteins [(PUBMED:10480904)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GRIN_C