The domain within your query sequence starts at position 641 and ends at position 755; the E-value for the GSAP-16 domain shown below is 2e-42.
LDYISKLLDLIWCLLETSWRKHSMHPLVLHLNSHCSAADFEVFHLMTRILDAASSLCLPL PPGFHSLHTILGVHCLPLYSLLHYIDNGVLLLTETAVTRLMKDLDNSEKNEQLKF
GSAP-16 |
---|
PFAM accession number: | PF14959 |
---|---|
Interpro abstract (IPR028010): | The gamma-secretase-activating protein (GSAP) family includes the mammalian GSAPs and the insect pigeon proteins (also known as linotte proteins). GSAP is a gamma-secretase regulator. It specifically activates the production of beta-amyloid protein through interactions with both gamma-secretase and its substrate, the amyloid precursor protein carboxy-terminal fragment (APP-CTF) [ (PUBMED:20811458) ]. This has led to interest in the protein as potential therapeutic target for the treatment of Alzheimer's disease [ (PUBMED:20811458) ]. Pigeon/linotte was initially identified as a gene that functions in adult Drosophila during associative learning [ (PUBMED:7576632) ]. This entry represents a domain found in the C-terminal of GSAP family members. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GSAP-16