The domain within your query sequence starts at position 2 and ends at position 120; the E-value for the GSG-1 domain shown below is 2.9e-38.
DRARWQRMLTLLPICLALAFSLTAMGSSHWCEGIRRMTKPLCQDLLGGLNCIHFSRSSSS TGSKHDDSQAVQYIWETGDDKFIQRRFHAGLWQSCEESLNSTGERCRCFLGIVPAEGQG
GSG-1 |
---|
PFAM accession number: | PF07803 |
---|---|
Interpro abstract (IPR012478): | This entry represents GSG1 (germ cell-specific gene 1 protein), a protein specifically expressed in testicular germ cells [ (PUBMED:9337410) ]. It has been shown to target testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions [ (PUBMED:18325338) ]. Overexpression of the human homologue may be involved in tumourigenesis of human testicular germ cell tumours [ (PUBMED:9337410) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GSG-1