The domain within your query sequence starts at position 35 and ends at position 109; the E-value for the GTF2I domain shown below is 7.6e-33.

LRKQVEMLFNTKYAKAIGTSEPVKVPYSKFLMHPEELFVLGLPEGISLRRPNCFGIAKLR
KILEASNSIQFVIKR

GTF2I

GTF2I
PFAM accession number:PF02946
Interpro abstract (IPR004212):

This region of sequence similarity is found up to six times in a variety of proteins including general transcription factor II-I (GTF2I). It has been suggested that this may be a DNA binding domain [ (PUBMED:9774679) (PUBMED:10198167) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTF2I