The domain within your query sequence starts at position 107 and ends at position 198; the E-value for the GTP-bdg_N domain shown below is 9.1e-15.
EWQVAEAAALVRALPGWSVASTLVVPSAAPGSRLVFGKGNFQDVTEKIKGCQDITSVFLN VERMAPPTKKELESAWGLRVFDRFTLVLHIFR
GTP-bdg_N |
![]() |
---|
PFAM accession number: | PF13167 |
---|---|
Interpro abstract (IPR025121): | This domain represents the N-terminal region of GTP-binding HflX-like proteins [ (PUBMED:19181811) (PUBMED:19824612) ]. These proteins interact with the 50S ribosome and are GTPases, hydrolysing GTP/GDP/ATP/ADP [ (PUBMED:19109926) ]. The N-terminal region is necessary for stability of the whole protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTP-bdg_N