The domain within your query sequence starts at position 39 and ends at position 106; the E-value for the GTPase_binding domain shown below is 2.8e-38.

SSDFKRLGLRKPALPRGLWLAKPSARVPGTKADRSSGGEVTLIDFGEEPVVPTPRPCAPS
LAQLAMDA

GTPase_binding

GTPase_binding
PFAM accession number:PF09027
Interpro abstract (IPR015116):

This entry represents the Cdc42 (a GTPase) binding domain. The domain is largely unstructured in the absence of Cdc42 [ (PUBMED:10360579) ]. Proteins containing this domain include the tyrosine-protein kinase sid-3 [ (PUBMED:22912399) ], the ERBB receptor feedback inhibitor 1, the activated CDC42 kinase 1 and the probable tyrosine-protein kinase kin-25.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTPase_binding