The domain within your query sequence starts at position 4 and ends at position 67; the E-value for the GTPase_binding domain shown below is 4.1e-36.
AGVAAQDIRVPLKTGFLHNGQALGNMKSCWGSHSEFENNFLNIDPITMAYNLNSPAQEHL TTVG
GTPase_binding |
---|
PFAM accession number: | PF09027 |
---|---|
Interpro abstract (IPR015116): | This entry represents the Cdc42 (a GTPase) binding domain. The domain is largely unstructured in the absence of Cdc42 [ (PUBMED:10360579) ]. Proteins containing this domain include the tyrosine-protein kinase sid-3 [ (PUBMED:22912399) ], the ERBB receptor feedback inhibitor 1, the activated CDC42 kinase 1 and the probable tyrosine-protein kinase kin-25. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTPase_binding