The domain within your query sequence starts at position 4 and ends at position 67; the E-value for the GTPase_binding domain shown below is 4.1e-36.

AGVAAQDIRVPLKTGFLHNGQALGNMKSCWGSHSEFENNFLNIDPITMAYNLNSPAQEHL
TTVG

GTPase_binding

GTPase_binding
PFAM accession number:PF09027
Interpro abstract (IPR015116):

This entry represents the Cdc42 (a GTPase) binding domain. The domain is largely unstructured in the absence of Cdc42 [(PUBMED:10360579)]. Proteins containing this domain include the probable tyrosine-protein kinase kin-25, the ERBB receptor feedback inhibitor 1 and the activated CDC42 kinase 1.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTPase_binding