SMART: Pfam domain GTSE1

The domain within your query sequence starts at position 8 and ends at position 108; the E-value for the GTSE1_N domain shown below is 2e-12.

IKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRGLAHRSNPNEVAPALQGVRFSLG
PLSPEKLEEILDEANRLAAQLEECALKDRERAGTGPGRPSP

GTSE1_N

PFAM accession number:	PF15259
Interpro abstract (IPR032768):	This entry represents the N terminus of GTSE1 proteins. GTSE-1 (G2 and S phase-expressed-1) protein is specifically expressed during S and G2 phases of the cell cycle. It is mainly localised to the microtubules and when overexpressed delays the G2 to M transition. the full protein negatively regulates p53 transactivation function, protein levels, and p53-dependent apoptosis [ (PUBMED:12750368) (PUBMED:20577264) ]. This domain is found in eukaryotes, and is approximately 140 amino acids in length. There is a conserved FDFD sequence motif.

PFAM accession number:

PF15259

Interpro abstract (IPR032768):

This entry represents the N terminus of GTSE1 proteins. GTSE-1 (G2 and S phase-expressed-1) protein is specifically expressed during S and G2 phases of the cell cycle. It is mainly localised to the microtubules and when overexpressed delays the G2 to M transition. the full protein negatively regulates p53 transactivation function, protein levels, and p53-dependent apoptosis [ (PUBMED:12750368) (PUBMED:20577264) ]. This domain is found in eukaryotes, and is approximately 140 amino acids in length. There is a conserved FDFD sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GTSE1_N