The domain within your query sequence starts at position 568 and ends at position 662; the E-value for the GUCT domain shown below is 3.7e-31.

GASSFEPRSLITSDKGFVTMTLESPEEIQDVSCAWKELNRKLSSNAVSHVTRMCLLKGNM
GVCFDVPTSESERLQAEWHDSDWILSVPAKLPEIE

GUCT

GUCT
PFAM accession number:PF08152
Interpro abstract (IPR012562):

This is the C-terminal domain found in the RNA helicase II / Gu protein family [(PUBMED:15112237)].

GO component:nucleus (GO:0005634)
GO function:helicase activity (GO:0004386), RNA binding (GO:0003723), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GUCT