The domain within your query sequence starts at position 5 and ends at position 294; the E-value for the G_path_suppress domain shown below is 6.1e-93.

LERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEE
TKEQILKLQEKLSALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHT
GTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSP
GGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFL
QPGSTLSLQKQMEHANQQTSFSDSSSLRPMHPQALHPAPGLLASPQLPVQ

G_path_suppress

G_path_suppress
PFAM accession number:PF15991
Interpro abstract (IPR026094): G protein pathway suppressor 2 is involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this protein could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this protein may be signal repression [(PUBMED:8943324)]. This protein is a component of the N-CoR-HDAC3 [(PUBMED:11931768)] and also the SMRT corepressor complexes [(PUBMED:19858209)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry G_path_suppress