The domain within your query sequence starts at position 125 and ends at position 615; the E-value for the Gaa1 domain shown below is 3.8e-155.

SGTNVYGILRAPRSASTESLVLTVPCGPDATNSQAVGLLLALAAHFRGQIYWAKDIIFLV
TDHDLLGTEAWLEAYHDINVTGIQSSPLQGRAGAIQAAVALELSSDVVTSLDVTVEGLNG
QLPNLDLLNLFQTFCQKGGLLCTLQGKLQPQDWTSLEGPLQGLQTLLLMVLRQASGRPHG
PHGLFLRYGVEALTLRGINSFRQYKYDLATVGKALEGMFRKLNHLLERLHQSFFFYLLPA
LSRFVSIGLYMPATGFLLLVLGLKALELWMQLHQAGVNPEEAGKAPSPGTPLLPTQGVGL
ASLTAPLLISQAMGLALYFLPVLGQHLATQHFPVAEAEAVVLTLLAIYVAGLALPHNTHR
VVNSQVPDRGWMALKLVALIYLALQLGCIALLNFSLGFLLAATMVPAAALAKPHGPRTLY
AALLVVTSPAVTLFGSLFLWRELLEVPLSLAEGWQLFLTALAQGVLEHYTYGALLFPILA
LGLYPCWLLFW

Gaa1

Gaa1
PFAM accession number:PF04114
Interpro abstract (IPR007246):

GPI (glycosyl phosphatidyl inositol) transamidase is a multiprotein complex required for a terminal step of adding the glycosylphosphatidylinositol (GPI) anchor attachment onto proteins. Gpi16, Gpi8 and Gaa1 form a sub-complex of the GPI transamidase.

GO component:integral component of membrane (GO:0016021), GPI-anchor transamidase complex (GO:0042765)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gaa1