The domain within your query sequence starts at position 4 and ends at position 226; the E-value for the Gal-3-0_sulfotr domain shown below is 5.3e-58.

TMRLWRPRSLGVALGVFMTIGFGLQFLGGSFQRRLPGLQLRQSWVPSLGSTVKSCLPRQR
LVFLKTHKSGSSSVLNLLHRYGDQQGLRFALPAHYQFGYPKLFQASKVKGYHPQSADTQK
PFHILCHHMRFNLKEVLQVMPSDSFFFSIVRDPAALARSAFSYYKSVSSAFRKAPSLAAF
LSNPQAFYRPGARGNHYARNLLWFDFGLPSPPETKTMKVSPQL

Gal-3-0_sulfotr

Gal-3-0_sulfotr
PFAM accession number:PF06990
Interpro abstract (IPR009729):

This family consists of several animal galactose-3-O-sulphotransferases, including GAL3ST1-4. GAL3ST1 (also known as Cst, cerebroside sulfotransferase) is responsible for the biosynthesis of two types of sulfoglycolipids, sulfatide (HSO3-3-galactosylceramide) and seminolipid (HSO3-3-monogalactosylalkylacylglycerol), in mammals. It catalyses the sulfation of membrane glycolipids and seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. It also catalyses the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes [ (PUBMED:11917099) ].

GO process:glycolipid biosynthetic process (GO:0009247)
GO component:integral component of membrane (GO:0016021)
GO function:galactosylceramide sulfotransferase activity (GO:0001733)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gal-3-0_sulfotr