The domain within your query sequence starts at position 18 and ends at position 67; the E-value for the GalKase_gal_bdg domain shown below is 2.6e-24.

RAFMEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELVTVMVGSP

GalKase_gal_bdg

GalKase_gal_bdg
PFAM accession number:PF10509
Interpro abstract (IPR019539):

This entry represents a highly conserved galactokinase signature sequence which appears to be present in all galactokinases, irrespective of how many other ATP binding sites, etc that they carry [(PUBMED:10359639)]. The function of this domain appears to be to bind galactose [(PUBMED:12796487)], and it is normally located at the N terminus of these enzymes [(PUBMED:15526155)]. It is associated with IPR013750 and IPR006204. While all enzymes in this entry posses galactokinase activity, some are annotated as N-acetylgalactosamine kinases as they also posses this enzyme activity.

GO function:galactose binding (GO:0005534)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GalKase_gal_bdg