The domain within your query sequence starts at position 43 and ends at position 123; the E-value for the Gal_Lectin domain shown below is 1.3e-26.
LRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAG PDVFPDPCPGTYKYLEVQYEC
Gal_Lectin |
---|
PFAM accession number: | PF02140 |
---|---|
Interpro abstract (IPR000922): | The D-galactoside binding lectin purified from sea urchin (Anthocidaris crassispina) eggs exists as a disulphide-linked homodimer of two subunits; the dimeric form is essential for hemagglutination activity [ (PUBMED:2001368) ]. The sea urchin egg lectin (SUEL) forms a new class of lectins. Although SUEL was first isolated as a D-galactoside binding lectin, it was latter shown that it bind to L-rhamnose preferentially [ (PUBMED:2001368) (PUBMED:10564781) ]. L-rhamnose and D-galactose share the same hydroxyl group orientation at C2 and C4 of the pyranose ring structure. A cysteine-rich domain homologous to the SUEL protein has been identified in the following proteins [ (PUBMED:9261169) (PUBMED:9668106) (PUBMED:9920906) ]:
|
GO function: | carbohydrate binding (GO:0030246) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gal_Lectin