The domain within your query sequence starts at position 280 and ends at position 431; the E-value for the Gar1 domain shown below is 2.3e-48.

LNELPSVEELTVILPEDIALKPLGKVSSIIEQLVIIESVTNIPPVNEDTVIFKSDRQAAG
KIFEIFGPVAHPFYVLRFNSSDHIESKGIKINDTMYFAPSMKDFTQYIFTEKLKQDRGSD
ASWKNDQEPPPEVLDFSDDEKEKEAKQRKKSQ

Gar1

Gar1
PFAM accession number:PF04410
Interpro abstract (IPR007504):

H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs. The function of these H/ACA RNPs is essential for biogenesis of the ribosome, splicing of precursor mRNAs (pre-mRNAs), maintenance of telomeres and probably for additional cellular processes [(PUBMED:16647858)]. All H/ACA RNPs contain a specific RNA component (snoRNA or scaRNA) and at least four proteins common to all such particles: Cbf5, Gar1, Nhp2 and Nop10. These proteins are highly conserved from yeast to mammals and homologues are also present in archaea [(PUBMED:10871366)]. The H/ACA protein complex contains a stable core composed of Cbf5 and Nop10, to which Gar1 and Nhp2 subsequently bind [(PUBMED:19917616)].

Naf1 is an RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex, disappearing during maturation of the complex and being replaced by Gar1 to yield mature H/ACA snoRNPs complex. The core domain of Naf1 is homologous to the core domain of Gar1, suggesting that they share a common Cbf5 binding surface [(PUBMED:17612558)].

GO process:ribosome biogenesis (GO:0042254), pseudouridine synthesis (GO:0001522)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gar1