The domain within your query sequence starts at position 1 and ends at position 184; the E-value for the Gasdermin domain shown below is 2.2e-34.
MFAAATKSFVKQVGDGGRLVPVPSLSEADKYQPLSLVVKKKRCFLFPRCKFTSTPFTLKD ILLGDREISAGISSYQLLNYEDESDVSLYGRRSNHIVNDVGINVTGSDSIAVKASFGVVT KHEVEVSTLLKEITARKINFDHSLIRQSRSSRKAVLCVVMESIRTTRQCSLSVHAGIRGE AMRF
Gasdermin |
![]() |
---|
PFAM accession number: | PF04598 |
---|---|
Interpro abstract (IPR040460): | The N-terminal domain of Gasdermins can bind membrane lipids, phosphoinositides and cardiolipin, and exhibits membrane-disrupting cytotoxicity. It was shown to be able to lyse phosphoinositide/cardiolipin-containing liposomes and form pores on membranes [ (PUBMED:27281216) ]. This entry represents the pore forming domain of gasdermin. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gasdermin