The domain within your query sequence starts at position 1 and ends at position 68; the E-value for the Gasdermin domain shown below is 3.1e-18.

MSFVKQVGDGGRLVPVPSLSEADKYQPLSLVVKKKRCFLFPRCKFTSTPFTLKDILLGDR
EISAGISS

Gasdermin

Gasdermin
PFAM accession number:PF04598
Interpro abstract (IPR040460):

The N-terminal domain of Gasdermins can bind membrane lipids, phosphoinositides and cardiolipin, and exhibits membrane-disrupting cytotoxicity. It was shown to be able to lyse phosphoinositide/cardiolipin-containing liposomes and form pores on membranes [ (PUBMED:27281216) ]. This entry represents the pore forming domain of gasdermin.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gasdermin