The domain within your query sequence starts at position 300 and ends at position 401; the E-value for the Gate domain shown below is 4.9e-11.

AFKILPIVVFFSTVMSMLYYLGLMQWIIRKVGWLMLVTMGSSPIESVVAAGNIFIGQTES
PLLVQPYLPHVTKSELHTIMTAGFATIAGSVLGAYISFGVSS

Gate

Gate
PFAM accession number:PF07670
Interpro abstract (IPR011642): This domain is responsible for determining nucleoside specificity in the human sodium/nucleoside cotransporter proteins CNT1 and CNT2 (e.g. O00337) [(PUBMED:10455109)]. In the FeoB proteins (e.g. O25396), which are believed to be Fe2+ transporters, it includes the membrane pore region, so the function of this domain is likely to be more general than just nucleoside specificity [(PUBMED:12781516)]. It may represent the pore and gate, with a wide potential range of specificity. Hence its name - Gate.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gate