SMART: Pfam domain Gb3

The domain within your query sequence starts at position 197 and ends at position 324; the E-value for the Gb3_synth domain shown below is 2.5e-49.

GFLPHHPFLWACMENFVEHYDSTIWGNQGPQLMTRMLRVWCRLKDFHGLGDLKCLNISFL
HPQRFYPIPYPQWKRYYQVWDKEPSFNESYALHLWNYMNKEGKTVVRGSKTLVENLYQKH
CPKTYRVL

Gb3_synth

PFAM accession number:	PF04572
Interpro abstract (IPR007652):	The glycosphingolipids (GSL) form part of eukaryotic cell membranes. They consist of a hydrophilic carbohydrate moiety linked to a hydrophobic ceramide tail embedded within the lipid bilayer of the membrane. Lactosylceramide, Gal1,4Glc1Cer (LacCer), is the common synthetic precursor to the majority of GSL found in vertebrates. Alpha 1.4-glycosyltransferases utilise UDP donors and transfer the sugar to a beta-linked acceptor [ (PUBMED:10854428) ]. No function has been yet assigned to this domain

PFAM accession number:

PF04572

Interpro abstract (IPR007652):

The glycosphingolipids (GSL) form part of eukaryotic cell membranes. They consist of a hydrophilic carbohydrate moiety linked to a hydrophobic ceramide tail embedded within the lipid bilayer of the membrane. Lactosylceramide, Gal1,4Glc1Cer (LacCer), is the common synthetic precursor to the majority of GSL found in vertebrates. Alpha 1.4-glycosyltransferases utilise UDP donors and transfer the sugar to a beta-linked acceptor [ (PUBMED:10854428) ].

No function has been yet assigned to this domain

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gb3_synth