The domain within your query sequence starts at position 228 and ends at position 355; the E-value for the Gb3_synth domain shown below is 2.3e-51.

AFERKHEFLALCLHDFVANYNGWIWGHQGPQLLTRVFKKWCSIQSLEKSHACRGVTALPP
EAFYPIPWQNWKKYFEDISPEELTQLLNATYAVHVWNKKSQGTHLEATSKALLAQLHARY
CPTTHRAM

Gb3_synth

Gb3_synth
PFAM accession number:PF04572
Interpro abstract (IPR007652):

The glycosphingolipids (GSL) form part of eukaryotic cell membranes. They consist of a hydrophilic carbohydrate moiety linked to a hydrophobic ceramide tail embedded within the lipid bilayer of the membrane. Lactosylceramide, Gal1,4Glc1Cer (LacCer), is the common synthetic precursor to the majority of GSL found in vertebrates. Alpha 1.4-glycosyltransferases utilise UDP donors and transfer the sugar to a beta-linked acceptor [ (PUBMED:10854428) ].

No function has been yet assigned to this domain

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gb3_synth