The domain within your query sequence starts at position 20 and ends at position 302; the E-value for the Gcd10p domain shown below is 7.2e-74.

CIHDGDFVVLKREDVFKAVQVQRRKKVTFEKQWFYLDNAIGHSYGSAFDVSSGGSLQLRK
KLEEPASETKEAGTDNRNIVDDGKSQKLTQDDIKALKDKGIKGEEIVQQLIENSTTFRDK
TEFAQDKYIKKKKKKYEAIVTILKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIR
AGNKMIVMETCSGLVLGAMMERMGGFGSIIQLYPGDGPVRAATACFGFPKSFLSGLYEFP
LNKVNSLLNGTFSAEMLSSEPKDSTPVEESNGELEEKEIAEQA

Gcd10p

Gcd10p
PFAM accession number:PF04189
Interpro abstract (IPR017423): TRM6, also known as Gcd10 in budding yeasts, is a substrate-binding subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyses the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA [(PUBMED:10779558), (PUBMED:16043508)].
GO process:tRNA methylation (GO:0030488)
GO component:tRNA (m1A) methyltransferase complex (GO:0031515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gcd10p