The domain within your query sequence starts at position 417 and ends at position 515; the E-value for the GidB domain shown below is 9e-9.

MSTDRALRKQQQLNNLVYLVLNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKE
LSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVALH

GidB

GidB
PFAM accession number:PF02527
Interpro abstract (IPR003682):

This entry represents a rRNA small subunit methyltransferase G. Previously identified as a glucose-inhibited division protein B that appears to be present and in a single copy in all complete eubacterial genomes so far sequenced. Specifically methylates the N7 position of a guanosine in 16S rRNA [(PUBMED:12001236), (PUBMED:17238915), (PUBMED:17573471)].

GO process:rRNA processing (GO:0006364)
GO component:cytoplasm (GO:0005737)
GO function:rRNA methyltransferase activity (GO:0008649)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GidB