The domain within your query sequence starts at position 24 and ends at position 104; the E-value for the Gln-synt_N domain shown below is 1.1e-15.
EKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSEGSNSDMYLHPVA MFRDPFRKDPNKLVLCEVFKY
Gln-synt_N |
---|
PFAM accession number: | PF03951 |
---|---|
Interpro abstract (IPR008147): | Glutamine synthetase ( EC 6.3.1.2 ) (GS) [ (PUBMED:2900091) ] plays an essential role in the metabolism of nitrogen by catalysing the condensation of glutamate and ammonia to form glutamine. This entry represents the glutamine synthetase N-terminal domain, which adopts a beta-grasp fold [ (PUBMED:17605815) ] and contributes to the substrate binding pocket of the enzyme [ (PUBMED:2876389) ]. |
GO process: | glutamine biosynthetic process (GO:0006542), nitrogen compound metabolic process (GO:0006807) |
GO function: | glutamate-ammonia ligase activity (GO:0004356) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gln-synt_N