The domain within your query sequence starts at position 149 and ends at position 349; the E-value for the Glu_dehyd_C domain shown below is 5.1e-12.
FEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSAS RLTKAKEVGADFTIQVGKETPQEIASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGG TLVIVGMGAEMVNLPLVHAAIREVDIKGVFRYCNTWPMAISMLASKTLNVKPLVTHRFPL EKAVEAFETAKKGVGLKVMIK
Glu_dehyd_C |
---|
PFAM accession number: | PF16912 |
---|---|
Interpro abstract (IPR031640): | Glucose 1 dehydrogenase ( EC 1.1.1.47 ) belongs to the medium-chain alcohol dehydrogenase superfamily and requires zinc for catalysis [ (PUBMED:8925901) (PUBMED:16511145) ]. It catalyses the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate via gluconolactone. It is involved in the degradation of glucose through a modified version of the Entner-Doudoroff pathway in Halobacteria [ (PUBMED:16511145) ] and a non-phosphorylative variant of the Entner-Doudoroff pathway in other organisms. This entry includes a group of glucose 1 dehydrogenases from archaea. This entry represents the C-terminal domain of glucose dehydrogenase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glu_dehyd_C