The domain within your query sequence starts at position 564 and ends at position 788; the E-value for the Glucosamine_iso domain shown below is 8.2e-66.

AWPEELISKLASDIEAAAVQAVRHFGKFHLALSGGSSPIALFQQLATGHYSFPWAHTHLW
LVDERCVPLSDPDSNFQGLQAHLLQHVRVPYYNIHPMPVHLHQRLCAEEDQGAQTYASEI
SALVANSSFDLVLLGMGTDGHTASLFPQSPTGLDGDQLVVLTESPFRPHQRMSLSLPLIN
RAKKVAVLVMGRTKREITTLVSRVGHEPKKWPISGVVPLSGQLVW

Glucosamine_iso

Glucosamine_iso
PFAM accession number:PF01182
Interpro abstract (IPR006148):

This domain is characteristic of the enzymes 6-phosphogluconolactonase (EC 3.1.1.31), Glucosamine-6-phosphate isomerase (EC 3.5.99.6), and Galactosamine-6-phosphate isomerase. 6-Phosphogluconolactonase is the enzyme responsible for the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate, the second step in the pentose phosphate pathway. Glucosamine-6-phosphate isomerase (or Glucosamine 6-phosphate deaminase) is the enzyme responsible for the conversion of D-glucosamine 6-phosphate into D-fructose 6-phosphate [(PUBMED:8747459)]. It is the last specific step in the pathway for N-acetylglucosamine (GlcNAC) utilization in bacteria such as Escherichia coli (gene nagB) or in fungi such as Candida albicans (gene NAG1).

GO process:carbohydrate metabolic process (GO:0005975)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glucosamine_iso