SMART: Pfam domain Gly_transf

The domain within your query sequence starts at position 97 and ends at position 221; the E-value for the Gly_transf_sug domain shown below is 2.6e-30.

NFLFMCSVESAARAHPESQVVVLMKGLPRDTTAQPRNLGISLLSCFPNVWIRPLDLQELF
EDTPLAAWYSEARHRWEPYQLPVLSDASRIALLWKFGGIYLDTDFIVLKNLLNLTNTLGI
QSRYV

Gly_transf_sug

PFAM accession number:	PF04488
Interpro abstract (IPR007577):	This entry represents those sugar-binding regions of glycosyltransferases that contain a DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases [ (PUBMED:9653120) ].

PFAM accession number:

PF04488

Interpro abstract (IPR007577):

This entry represents those sugar-binding regions of glycosyltransferases that contain a DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases [ (PUBMED:9653120) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gly_transf_sug