The domain within your query sequence starts at position 76 and ends at position 226; the E-value for the Glyco_hydro_1 domain shown below is 1.6e-19.

QYFSSLRASQVTHYKVLLSWAQLLPKGSSKNPDQEAVQCYRQLLQSLKDAQLQPMVVLFH
QMPPTSTIQRDGGFADLFADYATLAFQSFGDLVEIWFTFSDLEKVIMGLPHQHLKASGLQ
TLSDAHRKAFDVYHRKYSSQGGKLSVVLKAE

Glyco_hydro_1

Glyco_hydro_1
PFAM accession number:PF00232
Interpro abstract (IPR001360):

O-Glycosyl hydrolases (EC 3.2.1.) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [(PUBMED:7624375), (PUBMED:8535779)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.

Glycoside hydrolase family 1 comprises enzymes with a number of known activities; beta-glucosidase (EC 3.2.1.21); beta-galactosidase (EC 3.2.1.23); 6-phospho-beta-galactosidase (EC 3.2.1.85); 6-phospho-beta-glucosidase (EC 3.2.1.86); lactase-phlorizin hydrolase (EC 3.2.1.62), (EC 3.2.1.108); beta-mannosidase (EC 3.2.1.25); myrosinase (EC 3.2.1.147).

GO process:carbohydrate metabolic process (GO:0005975)
GO function:hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_1