The domain within your query sequence starts at position 8 and ends at position 923; the E-value for the Glyco_hydro_15 domain shown below is 7e-196.

GVRLDGYARLVHQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADR
DEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKTCATVVGD
DQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTADFGIWERG
DKTNQGISELNASSVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQSILNSLLP
RASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQGRYGCCRFLRDGYKTPKED
PNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQVQEYREALDAVLIKGKNGVP
LLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAPGEIDPLN
RRFSTVPKPDVVVQVSILAETEEIKAILKDKGIDVETIAEVYPIRVQPARILSHIYSSLG
CNSRMKLSGRPYRLMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNQMIVEMLRTDL
SYLCSRWRMTGQPTITFPISHTMLDEDGTSLNSSILAALRKMQDGYFGGARIQTGKLSEF
LTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDDLDSGNWMDSYDSTSNARCGDEVARYLDR
LLAHTVPHPKLAPTSRKGGLDRFRAAVQTTCDLMSLVAKAKELHIQNVHMYLPTKLFQPS
RPSLNLLDSPESPQDSQVPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYML
YSMKGPDWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISGILRKKVEALDEACTD
LLSYQKHLTVGLPPEPREKTISAPLPYEALTKLIDEASEGDMSISTLTQEIMVYLAMYMR
TQPGLFAEMFRLRIGL

Glyco_hydro_15

Glyco_hydro_15
PFAM accession number:PF00723
Interpro abstract (IPR011613):

This entry represents a domain found in glycoside hydrolase family 15 members and in phosphorylase b kinase regulatory chains alpha and beta [(PUBMED:18950708)].

Glycoside hydrolase family 15 comprises enzymes with several known activities; glucoamylase (EC 3.2.1.3); alpha-glucosidase (EC 3.2.1.20); glucodextranase (EC 3.2.1.70).

Phosphorylase b kinase catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin. The beta chain acts as a regulatory unit and modulates the activity of the holoenzyme in response to phosphorylation [(PUBMED:12825073)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_15