The domain within your query sequence starts at position 20 and ends at position 194; the E-value for the Glyco_hydro_20 domain shown below is 6.1e-10.

PYEGHLRLLRAKHAYSPSEVTEILRLARLSELEVIPLVQTFGHMEFVLKHAAFAHLREVA
LFPNTLNPHEAESLALVQAMIDQILELHRDVRWLHIGCDEVYYLGEGETSKQWLQQEQNS
HAKLCLSHMQAVASHVLTQHPGVTPLVWDDMLRDIPQEQLKASGVPQLVEPVLWD

Glyco_hydro_20

Glyco_hydro_20
PFAM accession number:PF00728
Interpro abstract (IPR015883):

Glycoside hydrolase family 20 comprises enzymes with several known activities; beta-hexosaminidase (EC 3.2.1.52); lacto-N-biosidase (EC 3.2.1.140); beta-1,6-N-acetylglucosaminidase); and beta-6-SO3-N-acetylglucosaminidase. Carbonyl oxygen of the C-2 acetamido group of the substrate acts as the catalytic nucleophile/base in this family of enzymes.

This entry represents the glycoside hydrolase family 20 catalytic domain. This domain has a TIM barrel fold.

GO process:carbohydrate metabolic process (GO:0005975)
GO function:hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_20