The domain within your query sequence starts at position 323 and ends at position 795; the E-value for the Glyco_hydro_31 domain shown below is 3.4e-145.

YVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYD
VQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNNGQKLVIILDPAISNNSFSSNPYGPY
DRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWI
DMNEVSNFIDGSFSGCSQNNLNYPPFTPKVLDGYLFSKTLCMDAVQHWGKQYDVHNLYGY
SMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNL
FGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNS
SRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITP
VLDQGAEKVKAYVPNATWYDYETGEELGWRKQSIEMQLPGDKIGLHLRGGYIF

Glyco_hydro_31

Glyco_hydro_31
PFAM accession number:PF01055
Interpro abstract (IPR000322):

O-Glycosyl hydrolases (EC 3.2.1.) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [(PUBMED:7624375), (PUBMED:8535779)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.

Glycoside hydrolase family 31 comprises enzymes with several known activities; alpha-glucosidase (EC 3.2.1.20), alpha-galactosidase (EC 3.2.1.22); glucoamylase (EC 3.2.1.3), sucrase-isomaltase (EC 3.2.1.48); isomaltase (EC 3.2.1.10); alpha-xylosidase (EC 3.2.1); alpha-glucan lyase (EC 4.2.2.13).

Glycoside hydrolase family 31 groups a number of glycosyl hydrolases on the basis of sequence similarities [(PUBMED:1747104), (PUBMED:1761061), (PUBMED:1743281)]. An aspartic acid has been implicated [(PUBMED:1856189)] in the catalytic activity of sucrase, isomaltase, and lysosomal alpha-glucosidase.

GO process:carbohydrate metabolic process (GO:0005975)
GO function:hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_31