The domain within your query sequence starts at position 79 and ends at position 178; the E-value for the Glyco_hydro_4 domain shown below is 2.1e-8.
VADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCTIIVVS NPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEK
Glyco_hydro_4 |
---|
PFAM accession number: | PF02056 |
---|---|
Interpro abstract (IPR001088): | O-Glycosyl hydrolases ( EC 3.2.1. ) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [ (PUBMED:7624375) (PUBMED:8535779) ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) website. Glycoside hydrolase family 4 comprises enzymes with several known activities; 6-phospho-beta-glucosidase ( EC 3.2.1.86 ); 6-phospho-alpha-glucosidase ( EC 3.2.1.122 ); alpha-galactosidase ( EC 3.2.1.22 ). 6-phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity [ (PUBMED:9765262) ]. |
GO process: | carbohydrate metabolic process (GO:0005975) |
GO function: | hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_4