The domain within your query sequence starts at position 349 and ends at position 832; the E-value for the Glyco_hydro_63 domain shown below is 7e-202.

LVGSQLTQALESHAAAFKERFEKTFQLKEKGLSPEEQALGQVALSGLLGGIGYFYGQGLV
LPDTSMEGSEQKMDPALFPPVPLFSGVPSRSFFPRGFLWDEGFHQLVVQRWDPHLTREAL
GHWLGLLNADGWIGREQILGDEARARVPPEFLVQRAAHANPPTLLLPVVHMLEGHDPDDL
AFLRKAFPRLHAWFSWLHQSQAGPVPLSYRWRGRDLALPTLLNPKTLPSGLDDYPRASHP
STAERHLDLRCWVALGARVLSQLAEQLGETEAAAELGPLAASLEEPGSLDELHWAPELGV
FADFGNHTKAVQLKSRPPQGLVRVVGRPPPRLQYVDALGYVSLFPLLLQLLDPSSPRLGP
LLDVLADSRHLWSPFGLRSLSASSLFYKQRNTEHDPPYWRGAVWLNINYLALGALHHYGH
VEGPHKVQAAKLYHELRANVVRNVRQQYQATGFLWEQYSDQDGRGMGCRPFQGWTSLVLL
IMAE

Glyco_hydro_63

Glyco_hydro_63
PFAM accession number:PF03200
Interpro abstract (IPR031335):

Enzymes belonging to glycosyl hydrolase family 63 catalyse the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC 3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway.

This entry represents the C-terminal catalytic domain [(PUBMED:23536181)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_63