The domain within your query sequence starts at position 91 and ends at position 267; the E-value for the Glyco_hydro_63N domain shown below is 1.1e-54.

ELFWGTYRPHVYFGMKTRSPKPLLTGLMWAQQGATPGTPPKLRHTCEQGDGVGPYGWEFH
DGRTFGRQHIHDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQASGTPSFPLVSLFFYVVT
DGQEVLLPEIGAKGQLKSISGHTSELGDFRLTLLPPTSPGDTVPKHGSYNVFWSSNP

Glyco_hydro_63N

Glyco_hydro_63N
PFAM accession number:PF16923
Interpro abstract (IPR031631):

This entry represents the N-terminal beta sandwich domain found in glycosyl hydrolase family 63 proteins [(PUBMED:23536181)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_63N