The domain within your query sequence starts at position 91 and ends at position 267; the E-value for the Glyco_hydro_63N domain shown below is 1.1e-54.
ELFWGTYRPHVYFGMKTRSPKPLLTGLMWAQQGATPGTPPKLRHTCEQGDGVGPYGWEFH DGRTFGRQHIHDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQASGTPSFPLVSLFFYVVT DGQEVLLPEIGAKGQLKSISGHTSELGDFRLTLLPPTSPGDTVPKHGSYNVFWSSNP
Glyco_hydro_63N |
---|
PFAM accession number: | PF16923 |
---|---|
Interpro abstract (IPR031631): | This entry represents the N-terminal beta sandwich domain found in glycosyl hydrolase family 63 proteins [ (PUBMED:23536181) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_63N